HPA017572

MARC2 antibody from Sigma-Aldrich
FLJ20605, MOSC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017572
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017572, RRID:AB_1848778
Product name
Anti-MOSC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017572
Antibody type
Polyclonal
Antigen
MOSC domain-containing protein 2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIF
RAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDC
GNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLL
PTL
Storage
-20C
Provider Type Product Number
- No reagents -