HPA017572

antibody from Atlas Antibodies

Targeting: MTARC2 FLJ20605, MARC2, MOSC2

Antibody data

Submit

Validation data

Product number: HPA017572 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017572, RRID:AB_1848778
Product name: Anti-MARC2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIF RAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDC GNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLL PTL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MTARC2 protein structure - HPA017572 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human parathyroid gland and lymph node tissues using Anti-MARC2 antibody. Corresponding MARC2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, lymph node and parathyroid gland using Anti-MARC2 antibody HPA017572 (A) shows similar protein distribution across tissues to independent antibody HPA015085 (B).
Antibody #2 product nr: HPA015085
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MARC2 antibody HPA017572.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MARC2 antibody HPA017572.
Sample type: HUMAN