WH0051003M1

MED31 antibody from Sigma-Aldrich
CGI-125, Soh1
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0051003M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0051003M1, RRID:AB_1842412
Product name
Monoclonal Anti-MED31 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0051003M1
Antibody type
Monoclonal
Antigen
MED31 (AAH12539, a.a. 1-132) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLN
FLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP
QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHW
QHYSRKRMRLQQALAEQQQQNNTSGK* (withou
t GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -