HPA035947

MED31 antibody from Atlas Antibodies
CGI-125, Soh1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035947
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035947, RRID:AB_10696646
Product name
Anti-MED31
Provider product page
Atlas Antibodies - HPA035947
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNF
LAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQ
C
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -