Antibody data

Product number
H00051003-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051003-M01, RRID:AB_437114
Product name
MED31 monoclonal antibody (M01), clone 2C8
Provider product page
Abnova Corporation - H00051003-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant MED31.
Antigen sequence
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLN
FLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP
QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHW
QHYSRKRMRLQQALAEQQQQNNTSGK
Isotype
IgG
Antibody clone number
2C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -