HPA031106

FRYL antibody from MilliporeSigma / Merck KGaA
AF4p12, DKFZp686E205, KIAA0826, MOR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031106
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031106, RRID:AB_10600660
Product name
Anti-FRYL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031106
Antibody type
Polyclonal
Antigen
FRY-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEE
HVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPE
PLAPESYPESVC
Storage
-20C
Provider Type Product Number
- No reagents -