Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449826 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Adenosine Deaminase, RNA-Specific, B2 (ADARB2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human ADARB2
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSA
DLEIINATTGRRSCG- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Nucleolar proteome dynamics.
Andersen JS, Lam YW, Leung AK, Ong SE, Lyon CE, Lamond AI, Mann M
Nature 2005 Jan 6;433(7021):77-83
Nature 2005 Jan 6;433(7021):77-83
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Heart; WB Suggested Anti-ADARB2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart; ADARB2 antibody - middle region (AP43188PU-N) in Human Heart cells using Western Blot