H00140890-B01P

SREK1 antibody from Abnova Corporation
DKFZp564B176, SFRS12, SRrp508, SRrp86

Antibody data

Product number
H00140890-B01P
Provider
Abnova Corporation
Product name
SFRS12 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00140890-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SFRS12 protein.
Antigen sequence
MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAA
ALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYV
GNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQP
TRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHS
NNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISA
AIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRR
KRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKS
RERRKSRSRSHSRDKRKDTREKIKEKERVKEKDRE
KEREREKEREKEKERGKNKDRDKEREKDREKDKEK
DREREREKEHEKDRDKEKEKEQDKEKEREKDRSKE
IDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRR
SRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKRE
KERDHISERRERERSTSMRKSSNDRDGKEKLEKNS
TSLKEKEHNKEPDSSVSKEVDDKDAPRTEENKIQH
NGNCQLNEENLSTKTEAV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -