HPA015089

EQTN antibody from MilliporeSigma / Merck KGaA
AFAF, C9orf11, equatorin, SPACA8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015089
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015089, RRID:AB_1845795
Product name
Anti-C9orf11 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015089
Antibody type
Polyclonal
Antigen
Acrosome formation-associated factor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCESQYSVNPELATMSYFHPSEGVSDTSFSKSAES
STFLGTTSSDMRRSGTRTSESKIMTDIISIGSDNE
MHENDESVTR
Storage
-20C
Provider Type Product Number
- No reagents -