HPA015504

EQTN antibody from Sigma-Aldrich
AFAF, C9orf11, equatorin, SPACA8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015504
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015504, RRID:AB_2067598
Product name
Anti-C9orf11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015504
Antibody type
Polyclonal
Antigen
Acrosome formation-associated factor Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYV
FTTQNPNGTESEISVRATTDLNFALKNGSTPNVPA
FWTMLAKAINGTAVVMDDKDQLFHPIPESDVNATQ
GENQPDLEDLKIK
Storage
-20C
Provider Type Product Number
- No reagents -