HPA007988

DNAJC15 antibody from MilliporeSigma / Merck KGaA
DNAJD1, MCJ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007988
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007988, RRID:AB_1078694
Product name
Anti-DNAJC15 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007988
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMS
RREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKG
GSPYVAAKINEAKDLLETTTKH
Storage
-20C
Provider Type Product Number
- No reagents -