Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405615 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 37 Member 1 (SLC37A1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC37A1 antibody: synthetic peptide directed towards the middle region of human SLC37A1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVD
HLDAK KAGELSTLFD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
Pope SN, Lee IR
The Journal of steroid biochemistry and molecular biology 2005 Feb;94(1-3):203-8
The Journal of steroid biochemistry and molecular biology 2005 Feb;94(1-3):203-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting