HPA030418

SLC37A1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030418
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030418, RRID:AB_10601602
Product name
Anti-SLC37A1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030418
Antibody type
Polyclonal
Antigen
solute carrier family 37 (glycerol-3-phosphate transporter), member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQL
PDNETDCGWAPFDKNNY
Storage
-20C
Provider Type Product Number
- No reagents -