Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311154 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transglutaminase 5 (TGM5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TGM5 antibody: synthetic peptide directed towards the C terminal of human TGM5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKD
IKGYR NVYVDFAL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A homozygous missense mutation in TGM5 abolishes epidermal transglutaminase 5 activity and causes acral peeling skin syndrome.
Cassidy AJ, van Steensel MA, Steijlen PM, van Geel M, van der Velden J, Morley SM, Terrinoni A, Melino G, Candi E, McLean WH
American journal of human genetics 2005 Dec;77(6):909-17
American journal of human genetics 2005 Dec;77(6):909-17
No comments: Submit comment
No validations: Submit validation data