HPA007989

ALG5 antibody from Atlas Antibodies
bA421P11.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007989
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007989, RRID:AB_1078132
Product name
Anti-ALG5
Provider product page
Atlas Antibodies - HPA007989
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPS
YNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVV
DDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGK
GGAIRMGIFSSRGEKILMADADGATKFPDVEKLEK
GLNDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -