HPA007989

ALG5 antibody from Sigma-Aldrich
bA421P11.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007989
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007989, RRID:AB_1078132
Product name
Anti-ALG5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007989
Antibody type
Polyclonal
Antigen
Dolichyl-phosphate beta-glucosyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPS
YNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVV
DDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGK
GGAIRMGIFSSRGEKILMADADGATKFPDVEKLEK
GLNDL
Storage
-20C
Provider Type Product Number
- No reagents -