H00001102-M06A

RCBTB2 antibody from Abnova Corporation
CHC1L
No application information provided.

Antibody data

Product number
H00001102-M06A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001102-M06A, RRID:AB_1204905
Product name
RCBTB2 monoclonal antibody (M06A), clone 4G12
Provider product page
Abnova Corporation - H00001102-M06A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RCBTB2.
Antigen sequence
TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEV
FTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVI
EVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTV
NQPI
Isotype
IgG
Antibody clone number
4G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -