Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054940-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054940-B01P, RRID:AB_1138740
- Product name
- OCIAD1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human OCIAD1 protein.
- Antigen sequence
MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVF
AECNDESFWFRSVPLAATSMLITQGLISKGILSSH
PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKL
ENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG
QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTG
ITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY
EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The influence of neural cell adhesion molecule isoform 140 on the metastasis of thyroid carcinoma.
Expression of NCAM and OCIAD1 in well-differentiated thyroid carcinoma: correlation with the risk of distant metastasis.
Yang AH, Chau YP, Lee CH, Chen JY, Chen JY, Ke CC, Liu RS
Clinical & experimental metastasis 2013 Mar;30(3):299-307
Clinical & experimental metastasis 2013 Mar;30(3):299-307
Expression of NCAM and OCIAD1 in well-differentiated thyroid carcinoma: correlation with the risk of distant metastasis.
Yang AH, Chen JY, Lee CH, Chen JY
Journal of clinical pathology 2012 Mar;65(3):206-12
Journal of clinical pathology 2012 Mar;65(3):206-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- OCIAD1 MaxPab polyclonal antibody. Western Blot analysis of OCIAD1 expression in human pancreas.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of OCIAD1 expression in transfected 293T cell line (H00054940-T01) by OCIAD1 MaxPab polyclonal antibody.Lane 1: OCIAD1 transfected lysate(27.06 KDa).Lane 2: Non-transfected lysate.