WH0083886M2

PRSS27 antibody from MilliporeSigma / Merck KGaA
CAPH2, MPN
ELISA
Recommended by provider

Antibody data

Product number
WH0083886M2
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0083886M2, RRID:AB_1842377
Product name
Monoclonal Anti-PRSS27 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0083886M2
Antibody type
Monoclonal
Antigen
PRSS27 (NP_114154, a.a. 94-204) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
QLVQPGPHAMYARVRQVESNPLYQGTASSADVALV
ELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGW
GSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKD
TEFGY* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -