H00083886-A01

PRSS27 antibody from Abnova Corporation
CAPH2, MPN
No application information provided.

Antibody data

Product number
H00083886-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083886-A01, RRID:AB_606853
Product name
PRSS27 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00083886-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant PRSS27.
Antigen sequence
QLVQPGPHAMYARVRQVESNPLYQGTASSADVALV
ELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGW
GSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKD
TEFGY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -