H00083886-M02

PRSS27 antibody from Abnova Corporation
CAPH2, MPN
No application information provided.

Antibody data

Product number
H00083886-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083886-M02, RRID:AB_566106
Product name
PRSS27 monoclonal antibody (M02), clone 6F11
Provider product page
Abnova Corporation - H00083886-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PRSS27.
Antigen sequence
QLVQPGPHAMYARVRQVESNPLYQGTASSADVALV
ELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGW
GSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKD
TEFGY
Isotype
IgG
Antibody clone number
6F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -