HPA011949

SIL1 antibody from Sigma-Aldrich
BAP, MSS, ULG5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011949, RRID:AB_1856875
Product name
Anti-SIL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011949
Antibody type
Polyclonal
Antigen
Nucleotide exchange factor SIL1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERKETKAEEELDAEVLEVFHPTHEWQALQPGQAVP
AGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLDI
NTNTYTSQDLKSALAKFKEGAEMESSKEDKARQAE
VKRLFRPIEELKKDFDELNVV
Storage
-20C
Provider Type Product Number
- No reagents -