Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023647-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023647-M01, RRID:AB_489720
- Product name
- ARFIP2 monoclonal antibody (M01), clone 2B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARFIP2.
- Antigen sequence
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDL
QQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRH
PSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYK
CTKQL- Isotype
- IgG
- Antibody clone number
- 2B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Recruitment of arfaptins to the trans-Golgi network by PI(4)P and their involvement in cargo export.
Arfaptins are localized to the trans-Golgi by interaction with Arl1, but not Arfs.
Cruz-Garcia D, Ortega-Bellido M, Scarpa M, Villeneuve J, Jovic M, Porzner M, Balla T, Seufferlein T, Malhotra V
The EMBO journal 2013 Jun 12;32(12):1717-29
The EMBO journal 2013 Jun 12;32(12):1717-29
Arfaptins are localized to the trans-Golgi by interaction with Arl1, but not Arfs.
Man Z, Kondo Y, Koga H, Umino H, Nakayama K, Shin HW
The Journal of biological chemistry 2011 Apr 1;286(13):11569-78
The Journal of biological chemistry 2011 Apr 1;286(13):11569-78
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ARFIP2 monoclonal antibody (M01), clone 2B5 Western Blot analysis of ARFIP2 expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ARFIP2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
