HPA008150

TMPO antibody from Atlas Antibodies
LAP2, LEMD4, TP
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA008150
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008150, RRID:AB_888558
Product name
Anti-TMPO
Provider product page
Atlas Antibodies - HPA008150
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLP
TISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEK
REPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEW
TSGSSKGGPLQALTRESTRGSRRTPRKRVETSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -