HPA008150

TMPO antibody from Atlas Antibodies
LAP2, LEMD4, TP
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA008150
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008150, RRID:AB_1079235
Product name
Anti-TMPO
Provider product page
Atlas Antibodies - HPA008150
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLP
TISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEK
REPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEW
TSGSSKGGPLQALTRESTRGSRRTPRKRVETSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -