HPA008150

TMPO antibody from Sigma-Aldrich
LAP2, LEMD4, TP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008150
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008150, RRID:AB_1079235
Product name
Anti-TMPO antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008150
Antibody type
Polyclonal
Antigen
Lamina-associated polypeptide 2, isoforms beta/gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLP
TISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEK
REPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEW
TSGSSKGGPLQALTRESTRGSRRTPRKRVETSE
Storage
-20C
Provider Type Product Number
- No reagents -