WH0002953M1

GSTT2B antibody from Sigma-Aldrich
GSTT2P
ELISA
Recommended by provider

Antibody data

Product number
WH0002953M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0002953M1, RRID:AB_1841799
Product name
Monoclonal Anti-GSTT2 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0002953M1
Antibody type
Monoclonal
Antigen
GSTT2 (NP_000845, a.a. 145-245) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVAL
GYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIIL
SILEQAAKKTLPTPSPEAYQAMLLRIARIP* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -