HPA000750

GSTT2B antibody from Atlas Antibodies
GSTT2P
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000750
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000750, RRID:AB_1849804
Product name
Anti-GSTT2B
Provider product page
Atlas Antibodies - HPA000750
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGV
QVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQ
QVTLADLMALEELMQPVALGYELFEGRPRLAAWRG
RVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSP
GAPHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -