HPA000750

GSTT2B antibody from Sigma-Aldrich
GSTT2P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000750, RRID:AB_1849804
Product name
Anti-GSTT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000750
Antibody type
Polyclonal
Antigen
Glutathione S-transferase theta 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGV
QVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQ
QVTLADLMALEELMQPVALGYELFEGRPRLAAWRG
RVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSP
GAPHR
Storage
-20C
Provider Type Product Number
- No reagents -