HPA000750

GSTT2B antibody from MilliporeSigma / Merck KGaA
GSTT2P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000750
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-GSTT2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA000750
Antibody type
Polyclonal
Antigen
Glutathione S-transferase theta 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGV
QVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQ
QVTLADLMALEELMQPVALGYELFEGRPRLAAWRG
RVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSP
GAPHR
Storage
-20C