ABIN405082

AKAP1 antibody from antibodies-online
AKAP121, AKAP149, AKAP84, D-AKAP1, PPP1R43, PRKA1, S-AKAP84, SAKAP84, TDRD17

Antibody data

Product number
ABIN405082
Provider
antibodies-online
Product name
anti-A Kinase (PRKA) Anchor Protein 1 (AKAP1) antibody
Provider product page
antibodies-online - ABIN405082
Antibody type
Polyclonal
Antigen
The immunogen for anti-AKAP1 antibody: synthetic peptide directed towards the C terminal of human AKAP1
Reactivity
Human
Host
Rabbit
Antigen sequence
VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAP
PPGKR GTLITRCPGF
Vial size
50 µg
Provider Type Product Number
- No reagents -