HPA008691

AKAP1 antibody from Atlas Antibodies
AKAP121, AKAP149, AKAP84, D-AKAP1, PPP1R43, PRKA1, S-AKAP84, SAKAP84, TDRD17
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008691
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008691, RRID:AB_887605
Product name
Anti-AKAP1
Provider product page
Atlas Antibodies - HPA008691
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPV
QEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVAD
AKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRN
EESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQ
V
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -