HPA008691

AKAP1 antibody from Sigma-Aldrich
AKAP121, AKAP149, AKAP84, D-AKAP1, PPP1R43, PRKA1, S-AKAP84, SAKAP84, TDRD17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008691, RRID:AB_1078119
Product name
Anti-AKAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008691
Antibody type
Polyclonal
Antigen
A kinase anchor protein 1, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPV
QEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVAD
AKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRN
EESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQ
V
Storage
-20C
Provider Type Product Number
- No reagents -