HPA038688

CAPZA3 antibody from Atlas Antibodies
CAPPA3, Gsg3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA038688
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038688, RRID:AB_2676151
Product name
Anti-CAPZA3
Provider product page
Atlas Antibodies - HPA038688
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKL
MHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVM
GDYRFFDHQSKLSFKYDLLQN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -