Antibody data

Product number
ABIN504506
Provider
antibodies-online
Product name
anti-Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3) antibody
Provider product page
antibodies-online - ABIN504506
Antibody type
Polyclonal
Antigen
The immunogen for anti-CAPZA3 antibody: synthetic peptide directed towards the N terminal of human CAPZA3
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLC
LLIRD EKLMHHQGEC
Vial size
50 µg
Provider Type Product Number
- No reagents -