SAB1400771

CAPZA3 antibody from Sigma-Aldrich
CAPPA3, Gsg3
ELISA
Recommended by provider

Antibody data

Product number
SAB1400771
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400771, RRID:AB_1840456
Product name
Monoclonal Anti-CAPZA3 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400771
Antibody type
Monoclonal
Antigen
CAPZA3 (NP_201585, a.a. 200-300) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Rat
Antigen sequence
NLHIEISKDLKESLEIVNQAQLALSFARLVEEQEN
KFQAAVLEELQELSNEALRKILRRDLPVTRTLIDW
HRILSDLNLVMYPKLGYVIYSRSVLCNWII* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -