HPA008397

LRAT antibody from Sigma-Aldrich
LCA14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008397
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008397, RRID:AB_1079273
Product name
Anti-LRAT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008397
Antibody type
Polyclonal
Antigen
Lecithin retinol acyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLG
DNRVAHMMPDILLALTDDM
Storage
-20C
Provider Type Product Number
- No reagents -