Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00081602-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00081602-M01, RRID:AB_606043
- Product name
- CDADC1 monoclonal antibody (M01), clone 1A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDADC1.
- Antigen sequence
KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISY
MRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENG
VLRPVPQKEEQHQDKKLRLGIH- Isotype
- IgG
- Antibody clone number
- 1A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CDADC1 monoclonal antibody (M01), clone 1A2. Western Blot analysis of CDADC1 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CDADC1 expression in transfected 293T cell line by CDADC1 monoclonal antibody (M01), clone 1A2.Lane 1: CDADC1 transfected lysate(58.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CDADC1 monoclonal antibody (M01), clone 1A2. Western Blot analysis of CDADC1 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CDADC1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol