WH0053947M8

A4GALT antibody from MilliporeSigma / Merck KGaA
A14GALT, Gb3S, P(k), P1
ELISA
Recommended by provider

Antibody data

Product number
WH0053947M8
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-A4GALT antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0053947M8
Antibody type
Monoclonal
Antigen
A4GALT (NP_059132, a.a. 254-354) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIP
WQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQG
TRFEATSRALLAQLHARYCPTTHEAMKMYL* (wi
thout GST)
Isotype
IgG
Storage
-20C