HPA001141

A4GALT antibody from Sigma-Aldrich
A14GALT, Gb3S, P(k)
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001141, RRID:AB_1078139
Product name
Anti-A4GALT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001141
Antibody type
Polyclonal
Antigen
Lactosylceramide 4-(alpha-galactosyltransferase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKN
LRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMR
DFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAES
RACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELP
RLLSATYAVH
Storage
-20C
Provider Type Product Number
- No reagents -