HPA008622

CSMD2 antibody from Sigma-Aldrich
KIAA1884
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008622
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008622, RRID:AB_1078579
Product name
Anti-CSMD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008622
Antibody type
Polyclonal
Antigen
CUB and sushi domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCN
AGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSC
GLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAG
AEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISV
EH
Storage
-20C
Provider Type Product Number
- No reagents -