H00152579-B01P

SCFD2 antibody from Abnova Corporation
FLJ39514, STXBP1L1

Antibody data

Product number
H00152579-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00152579-B01P, RRID:AB_1580393
Product name
SCFD2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00152579-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SCFD2 protein.
Antigen sequence
MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAES
LHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQ
PKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVT
TVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKL
CEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFAS
LFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTP
ELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQV
IAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTG
AVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALT
ALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNT
KHKEAVMEVRRHLVEAASRENLPIKMSMGRVTPGQ
LMSYIQLFKNNLKALMNHCGLLQLGLATAQTLKHP
QTAKWDNFLAFERLLLQSIGESAMSVVLNQLLPMI
KPVTQRTNEDYSPEELLILLIYIYSVTGELTVDKD
LCEAEEKVKKALAQVFCEESGLSPLLQKITDWDSS
INLTFHKSKIAVDELFTSLRDIAGARSLLKQFKSV
YVPGNHTHQASYKPLLKQVVEEIFHPERPDSVDIE
HMSSGLTDLLKTGFSMFMKVSRPHPSDYPLLILFV
VGGVTVSEVKMVKDLVASLKPGTQVIVLSTRLLKP
LNIPELLFATDRLHPDLGF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -