SAB1400821

SCFD2 antibody from Sigma-Aldrich
FLJ39514, STXBP1L1
ELISA
Recommended by provider

Antibody data

Product number
SAB1400821
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400821, RRID:AB_1856612
Product name
Anti-SCFD2 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400821
Antibody type
Polyclonal
Antigen
SCFD2 (NP_689753.2, a.a. 1-684) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MSASGVLSFTQQGWEQVLAKVKRAVVYLDAACAES
LHWGCGSTRLLEAVGGPDCHLREFEPDAIGGGAKQ
PKAVFVLSCLLKGRTVEILRDIICRSHFQYCVVVT
TVSHAVHLTANHVPAAAAAEMEGQQPVFEQLEEKL
CEWMGNMNYTAEVFHVPLLLAPVAPHFALTPAFAS
LFPLLPQDVHLLNSARPDKRKLGSLGDVDSTTLTP
ELLLQIRCLVSGLSSLCEHLGVREECFAVGSLSQV
IAADLANYAPAKNRKKTAAGRASVVFVDRTLDLTG
AVGHHGDNLVEKIISALPQLPGHTNDVMVNMIALT
ALHTEEENYNVVAPGCLSQSSDTTAKALWEALLNT
KHKEAVMEVRRHLVEAASRENLPIKMSMGRVTPGQ
LMSYIQLFKNNLKALMNHCGLLQLGLATAQTLKHP
QTAKWDNFLAFERLLLQSIGESAMSVVLNQLLPMI
Storage
-20C
Provider Type Product Number
- No reagents -