Antibody data
- Product number
- HPA053549
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA053549, RRID:AB_2682184
- Product name
- Anti-ZG16B
- Provider product page
- Atlas Antibodies - HPA053549
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQ
VLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVN
LTYSANSPVG
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & vesicles.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human salivary gland and colon tissues using Anti-ZG16B antibody. Corresponding ZG16B RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, liver, salivary gland and testis using Anti-ZG16B antibody HPA053549 (A) shows similar protein distribution across tissues to independent antibody HPA041125 (B).
- Antibody #2 product nr
- HPA041125
- Antibody provider
- Atlas Antibodies
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human salivary gland shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-ZG16B antibody HPA053549.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-ZG16B antibody HPA053549.
- Sample type
- HUMAN
Explore
Validate
Learn
Supportive data in Antibodypedia
Enhanced validation
