HPA009087

CLCC1 antibody from Sigma-Aldrich
MCLC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009087, RRID:AB_1078532
Product name
Anti-CLCC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009087
Antibody type
Polyclonal
Antigen
Mid-1-related chloride channel 1 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQM
GPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSP
EVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE
Storage
-20C
Provider Type Product Number
- No reagents -