Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039556 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039556, RRID:AB_10672778
- Product name
- Anti-GPCPD1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGMWDGNLSTYFDMNLFLDIILKTVLENSGKRRIV
FSSFDADICTMVRQKQNKYPILFLTQGKSEIYPEL
MDLRSRTTPIAMSFAQFENLLGINVHTEDLLRNPS
YIQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Dysregulation of choline metabolism and therapeutic potential of citicoline in Huntington's disease
Hypoxia-induced GPCPD1 depalmitoylation triggers mitophagy via regulating PRKN-mediated ubiquitination of VDAC1
Choline-releasing glycerophosphodiesterase EDI3 drives tumor cell migration and metastasis
Chang K, Cheng M, Tang H, Lin C, Chen C
Aging Cell 2024;23(11)
Aging Cell 2024;23(11)
Hypoxia-induced GPCPD1 depalmitoylation triggers mitophagy via regulating PRKN-mediated ubiquitination of VDAC1
Liu Y, Zhang H, Liu Y, Zhang S, Su P, Wang L, Li Y, Liang Y, Wang X, Zhao W, Chen B, Luo D, Zhang N, Yang Q
Autophagy 2023;19(9):2443-2463
Autophagy 2023;19(9):2443-2463
Choline-releasing glycerophosphodiesterase EDI3 drives tumor cell migration and metastasis
Stewart J, Marchan R, Lesjak M, Lambert J, Hergenroeder R, Ellis J, Lau C, Keun H, Schmitz G, Schiller J, Eibisch M, Hedberg C, Waldmann H, Lausch E, Tanner B, Sehouli J, Sagemueller J, Staude H, Steiner E, Hengstler J
Proceedings of the National Academy of Sciences 2012;109(21):8155-8160
Proceedings of the National Academy of Sciences 2012;109(21):8155-8160
No comments: Submit comment
No validations: Submit validation data