Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039556 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039556, RRID:AB_10672778
- Product name
- Anti-GPCPD1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGMWDGNLSTYFDMNLFLDIILKTVLENSGKRRIV
FSSFDADICTMVRQKQNKYPILFLTQGKSEIYPEL
MDLRSRTTPIAMSFAQFENLLGINVHTEDLLRNPS
YIQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Choline-releasing glycerophosphodiesterase EDI3 drives tumor cell migration and metastasis.
Stewart JD, Marchan R, Lesjak MS, Lambert J, Hergenroeder R, Ellis JK, Lau CH, Keun HC, Schmitz G, Schiller J, Eibisch M, Hedberg C, Waldmann H, Lausch E, Tanner B, Sehouli J, Sagemueller J, Staude H, Steiner E, Hengstler JG
Proceedings of the National Academy of Sciences of the United States of America 2012 May 22;109(21):8155-60
Proceedings of the National Academy of Sciences of the United States of America 2012 May 22;109(21):8155-60
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows cytoplasmic positivity in macrophages.
- Sample type
- HUMAN