H00056261-B01P

GPCPD1 antibody from Abnova Corporation
GDE5, GDPD6, KIAA1434

Antibody data

Product number
H00056261-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056261-B01P, RRID:AB_1580034
Product name
RP5-1022P6.2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00056261-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RP5-1022P6.2 protein.
Antigen sequence
MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQ
NAVALLPENDTGESMLWKATIVLSRGVSVQYRYFK
GYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESE
IIIDDGQFGIHNGVETLDSGWLTCQTEIRLRLHYS
EKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVS
PTVLHKMSNSLEISLISDNEFKCRHSQPECGYGLQ
PDRWTEYSIQTMEPDNLELIFDFFEEDLSEHVVQG
DALPGHVGTACLLSSTIAESGKSAGILTLPIMSRN
SRKTIGKVRVDYIIIKPLPGYSCDMKSSFSKYWKP
RIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAA
SHGAAFVEFDVHLSKDFVPVVYHDLTCCLTMKKKF
DADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFN
IEIKWICQQRDGMWDGNLSTYFDMNLFLDIILKTV
LENSGKRRIVFSSFDADICTMVRQKQNKYPILFLT
QGKSEIYPELMDLRSRTTPIAMSFAQFENLLGINV
HTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENR
RKLKELGVNGLIYDRIYDWMPEQPNIFQVEQLERL
KQELPELKSCLCPTVSRFVPSSLCGESDIHVDANG
IDNVENA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -