HPA031131

KCNV2 antibody from Atlas Antibodies
Kv8.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA031131
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031131, RRID:AB_10609996
Product name
Anti-KCNV2
Provider product page
Atlas Antibodies - HPA031131
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGN
YNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
PEGPSDPPALLSTLNVNVGGHSYQLDYCELA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -