HPA031131

KCNV2 antibody from Sigma-Aldrich
Kv8.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031131
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031131, RRID:AB_10609996
Product name
Anti-KCNV2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031131
Antibody type
Polyclonal
Antigen
potassium channel, subfamily V, member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGN
YNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
PEGPSDPPALLSTLNVNVGGHSYQLDYCELA
Storage
-20C
Provider Type Product Number
- No reagents -