Antibody data

Product number
H00064946-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064946-M01, RRID:AB_1204138
Product name
CENPH monoclonal antibody (M01), clone 1F7
Provider product page
Abnova Corporation - H00064946-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CENPH.
Antigen sequence
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAAC
SEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE
QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDR
MRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI
MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEI
QTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT
VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVD
MM
Isotype
IgG
Antibody clone number
1F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -