Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29565 - Provider product page

- Provider
- Abnova Corporation
- Product name
- CD244 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human CD244.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
WRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQ
EQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLI
QPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNP
ARLSRKELENFDVYS- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot (Transfected lysate) analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with CD244 polyclonal antibody (Cat # PAB29565) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver tissue with CD244 polyclonal antibody (Cat # PAB29565) shows strong cytoplasmic positivity in hepatocytes at 1:20 - 1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)