HPA010628

CD244 antibody from Sigma-Aldrich
2B4, NAIL, NKR2B4, Nmrk, SLAMF4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010628
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010628, RRID:AB_1078456
Product name
Anti-CD244 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010628
Antibody type
Polyclonal
Antigen
Natural killer cell receptor 2B4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQ
EQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLI
QPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNP
ARLSRKELENFDVYS
Storage
-20C
Provider Type Product Number
- No reagents -